PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G18840.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family NF-YA
Protein Properties Length: 273aa    MW: 30155.1 Da    PI: 7.4693
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G18840.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.78.2e-33121177158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQy++Il+RRq+Ra+le+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  LPERR07G18840.2 121 EEPIFVNAKQYHAILRRRQMRARLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 177
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.7E-37119180IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.665120180IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-27122177IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.7E-24123145IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.7E-24154177IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEEQRVTMPD YDFFSGGYQM KQLGHKMHDQ DSSSSDSSQS HQEESTMNDG SPNELHASTQ  60
SDNDDGHQKQ DQDNIKPVSS EGSPGASFPP PKLDYSQSFV YPQQNGTTNS RVPLPVEPAA  120
EEPIFVNAKQ YHAILRRRQM RARLEAQNKL VKGRKPYLHE SRHRHAMKRA RGSGGRFLNT  180
KQLEEQKQQQ EEEASGGASG TKAPGNSNTV CAPSAFAPSE TASVSTSREM PGNHEQNHFP  240
SAGFLPTMSF RAQNGGDGKL VASAIHQRVS MMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-22121182263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1161170RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880331e-156AB288033.1 Oryza sativa Japonica Group OsHAP2G mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1016841e-156AK101684.1 Oryza sativa Japonica Group cDNA clone:J033058N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646559.11e-135PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646560.11e-135PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646561.11e-135PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646562.11e-135PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ9SYH41e-39NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A0D9X1C30.0A0A0D9X1C3_9ORYZ; Uncharacterized protein
STRINGORGLA07G0166900.11e-135(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-30nuclear factor Y, subunit A5